Translate posts to Experimental | Feedback
Google
Official Google Earth Download Site
Page 1 of 9 1 2 3 4 5 6 7 8 9 >
Topic Options
Rate This Topic
Previous Topic
View All Topics Index
Next Topic
#309223 - 02/03/06 01:34 AM Extreme Series - Updated Everyday ***
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Sultan Qaboos Grands Mosque in Bausher, Sultanate of Oman :Largest Hand-woven Carpet and Chandelier on the Earth
The Sultan Qaboos Grand Mosque is the main Mosque in the Sultanate of Oman. The Mosque is built from 300,000 tonnes of Indian sandstone. The main musalla (prayer hall) is square (external dimensions 74.4 x 74.4 metres) with a central dome rising to a height of fifty metres above the floor. The dome and the main minaret (90 metres) and four flanking minarets (45.5 metres) are the mosque’s chief visual features. The main musalla can hold over 6,500 worshippers, while the women’s musalla can accommodate 750 worshippers. The outer paved ground can hold 8,000 worshippers and there is additional space available in the interior courtyard and the passageways, making a total capacity of up to 20,000 worshippers.
A major feature of the design of the interior is the prayer carpet which covers the floor of the prayer hall. It contains, 1,700,000 knots, weighs 21 tonnes and took four years to produce, and brings together the classical Tabriz, Kashan and Isfahan design traditions. 28 colors in varying shades were used, the majority obtained from traditional vegetable dyes. It is the largest single piece carpet in the world.



The world's largest hand-woven carpet was produced by Iran Carpet Company (ICC) at the order of the Diwan of the Royal Court of Sultanate of Oman to cover the entire floor of the main praying hall of the Sultan Qaboos Grand Mosque (SQGM) in Muscat. The carpet measures over 70 × 60 meters, and covers the 4,343 square meter area of the praying hall, all in a single piece.


Image Courtesy: National Geographic, read more here


This crystal chandelier in the mosque is about 46 feet high (picture a four story building!). It is about 26 feet in diameter, and it comes to a weight of 8.5 tons which is close to 20,000 pounds! The chandelier is made of 600,000 Swarovski crystals, has gold plated metalwork. It contains staircases and platforms, necessary for maintenance, and has 1,200 dimmable halogen lamps triggered by more than 36 switching circuits. Given that the height of the ceiling in the main minaret is 90 metres, this huge chandelier is probably actually the most efficient way of lighting up the entire space!

The Mosque is built on a site occupying 416,000 square metres and the complex extends to cover an area of 40,000 square metres. The newly built Grand Mosque was inaugurated by Sultan of Oman on May 4, 2001.
---------------------------------------------------------------------------------------
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu , New Zealand : Longest Name of a place on the Earth
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu is the Maori name for a hill, 305 m high, in New Zealand.The name on the sign that marks this hill, which translates roughly as - The summit where Tamatea, the man with the big knees, the climber of mountains, the land-swallower who traveled about, played his nose flute to his loved one. At 85 letters, it is one of the longest place names in the world and one of the longest words used in English.



There are other places which compete for the longest name, a village in Wales boasts a village called Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (58 letters), which in English means "Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave." The locals call it Llanfairpwll (pronounced thlan vire puth). Recently Bangkok is claiming that it has the longest name , Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit (163 letter), this claim is not yet officially recognized, who knows we might see this toppling the record for the longest name in the future but till then the city in New Zealand claims the top spot.
---------------------------------------------------------------------------------------
Tristan da Cunha : Remotest archipelago on the Earth
Tristan da Cunha is a group of remote volcanic islands in the south Atlantic Ocean, 2816 km from South Africa and 3360 km from South America, is an active volcanic island with rare wildlife & home to 268 British Citizens. Tristan da Cunha is the most remote archipelago in the world. It is a dependency of the British overseas territory of Saint Helena, 2173 km to the north. The territory consists of the main island, Tristan da Cunha (area: 98 km�, 38 sq mi ), as well as several uninhabited islands.
The islands were first sighted in 1506 by a Portuguese sailor, Trist�o da Cunha, although rough seas prevented a landing. He named the main island after himself, Ilha de Trist�o da Cunha, which was later anglicised to Tristan da Cunha Island.
The post office o nthis island is probably the remotest post office on the Earth !!

Copyright : pugsly2002(Travelpod)
---------------------------------------------------------------------------------------
Oymyakon, Russia : Coldest Inhabited place on the Earth
Oymyakon is a village in Oymyakonsky Ulus of the Sakha Republic, Russia, located along the Indigirka River.
Oymyakon is known as one of the candidates for the Northern Pole of Cold, because on January 26, 1926, a temperature of −71.2 �C (−96.2 �F) was recorded there (however, this fact is arguable because the temperature was not directly measured but obtained by extrapolation). This is the lowest recorded temperature for any permanently inhabited location on Earth. It is also the lowest temperature recorded in the Northern hemisphere, except for an unofficial lowest recorded temperature of −77.5 �C (−107.5 �F) at Mount Logan in the Yukon, Canada. Only Antarctica has recorded official lower temperatures with the lowest being −89.2 �C (−128.6 �F) near the Russian station of Vostok ( see my post below ).

Its name in the Sakha language means "non-freezing water"; due to the presence of a natural hot spring nearby. The ground there is permanently frozen.

Oxford geographer Nick Middleton's television series and accompanying book on people who live in extreme climates discusses his visit to this village, and describes ways in which inhabitants cope with the extreme cold. Middleton describes how Oymyakon lies between two mountain ranges, trapping cold air in between the entire year. Extreme cold temperatures are frequent annually in Oymyakon with temperatures going below −40 �C regularly, even in 2008 temperatures were observed well below this, −60.2 �C (−76.4 �F) was recorded on the 19th of January.
---------------------------------------------------------------------------------------
Shah Faisal Mosque, Islamabad, Pakistan : Largest Mosque on the Earth
The mosque has an area of 5,000 square meters and can hold about 300,000 worshipers, including those in the adjacent grounds. It is the largest mosque in the world, its relatively unusual design fuses contemporary lines with the more traditional look of an Arab Bedouin's tent, with its large triangular prayer hall and four minarets. However, unlike traditional mosque design, it lacks a dome, and like a tent, the weight of the main prayer hall in the center is supported by the four minarets. The minarets borrow their design from Turkish tradition and are thin pencil like. The interior of this prayer hall holds a very large chandelier and its walls are decorated with mosaics and calligraphy by the famous Pakistani artist Sadeqain. The mosaic pattern adorns the west wall, and has the 'Kalima' writtern in early kufic script, repeated in mirror image pattern.






Courtesy : Tribune India
The masjid's architecture is a departure from the long history of south Asian Muslim architecture, however in some ways it makes a bridge between Arabic, Turkish and Pakistani Muslim architectural traditions.

---------------------------------------------------------------------------------------------------

Nile, African continent : Longest River on the Earth
The Nile has two major tributaries, the White Nile and Blue Nile, the latter being the source of most of the Nile's water and fertile soil, but the former being the longer of the two. The White Nile rises in the Great Lakes region of central Africa, with the most distant source in southern Rwanda and flows north from there through Tanzania, Lake Victoria, Uganda and southern Sudan, while the Blue Nile starts at Lake Tana in Ethiopia flowing into Sudan from the southeast. The two rivers meet near the Sudanese capital Khartoum.
The northern section of the river flows almost entirely through desert, from Sudan into Egypt, a country whose civilization has depended on the river since ancient times. Most of the population of Egypt and all of its cities, with the exception of those near the coast, lie along those parts of the Nile valley north of Aswan; and nearly all the cultural and historical sites of Ancient Egypt are found along the banks of the river. The Nile ends in a large delta that empties into the Mediterranean Sea.
The word "Nile"(Arabic: 'nīl) comes from the Greek word Neilos (Νειλος), meaning river valley. In the ancient Egyptian language, the Nile is called iteru, meaning "great river", represented by the hieroglyphs shown here (literally itrw). In Coptic, the words piaro (Sahidic) or phiaro (Bohairic) meaning "the river" (lit. p(h).iar-o "the.canal-great") come from the same ancient name.

More discussion here

Photo Courtesy - www.richard-seaman.com
Some statistics
Length - 6,650 km (4,135 miles)
Drainage area - 2,870,000 sq km
Average Discharge - 5,100 cu meter / sec
Outflow - Mediterranean Sea
Countries in the drainage basin - Ethiopia, Eritrea, Sudan, Uganda, Tanzania, Kenya, Rwanda, Burundi, Egypt, Democratic Republic of the Congo

---------------------------------------------------------------------------------------------------

Dingo Fence , Australia : Longest Fence on the Earth
The Dingo Fence or Dog Fence is a pest-exclusion fence that was built in Australia during the 1880 - 85, to keep dingoes out of the relatively fertile south-east part of the continent and protect the sheep flocks of southern Queensland. It would eventually stretch 5,320 kilometers from Jimbour on the Darling Downs near Dalby through thousands of miles of arid country to the Eyre peninsula on the Great Australian Bight. It was only partly successful; Dingoes can still be found in parts of the southern states to this day, and although the fence helped reduce losses of sheep to predators, this was counterbalanced by increased pasture competition from rabbits and kangaros.

The 2500 km section of the fence in Queensland is also known as the Barrier Fence or Wild Dog Barrier Fence. It is administered by the Department of Natural Resources and Water. It joins the Border Fence in New South Wales, where it stretches for 584 km along Latitude 29. The fence passes the point where the three states of Queensland, New South Wales and South Australia meet (Cameron's corner), where there is a brass plate on the survey monument. It is known as the Dog Fence in South Australia, which is 2225 km long.


Image Courtesy - http://disordered.org

The fence is 6 feet (180 cm) high made of wire mesh, and extends for 1 foot (30 cm) underground. At first it was unsuccessfully used to try and keep out rabbits, with the fence built originally as a rabbit proof fence in 1884. It was more successful at keeping out pigs, kangaroos, emus and brumbies. In 1914 it was converted into a dog-proof fence

---------------------------------------------------------------------------------------------------
Burj Dubai ( Dubai Tower ), United Arab Emirates : Tallest Man made structure on the Earth
Burj Dubai is a skyscraper currently under construction in Dubai, United Arab Emirates, and is currently the tallest man-made structure on Earth. Construction began on September 21, 2004, and it is expected to be completed and ready for occupation in September 2009. As of 7 April 2008, Burj Dubai has reached a height of 629 m (2,064 ft), with 162 completed floors. Burj Dubai's final milestone will be to surpass the Warsaw radio mast in Konstantyn�w near Gabin, Poland (which stood at 646.4 m (2,121 ft) until it collapsed in 1991) to become the world's tallest structure of any type ever built.
It has already surpassed KVLY-TV mast, USA . Below are some of the other records this structure has
* Tallest structure: 629 m (2,064 ft) (previously KVLY-TV mast - 628.8 m (2,063 ft))
* Tallest freestanding structure: 629 m (2,064 ft) (previously CN Tower - 553.3 m (1,815 ft))
* Building with most floors: 164 (previously Sears Tower / World Trade Center - 110)[14]
* Highest Vertical concrete pumping (for a building): 601.0 m (1,972 ft) (previously Taipei 101 - 449.2 m (1,474 ft))
* Highest Vertical concrete pumping (for any construction): 601.0 m (1,972 ft) (previously Riva del Garda Hydroelectric Power Plant - 532 m (1,745 ft)[15])
Note: Additional records for tallest skyscraper are considered unofficial, as the CTBUH does not recognize records for buildings still under construction.


Image courtesy : burjdubaiskyscraper
The projected final height of Burj Dubai is officially being kept a secret due to competition from other buildings under construction or proposed; however, figures released by a contractor on the project have suggested a height of around 818 m (2,684 ft). Based on this height, the total number of habitable floors is expected to be around 162. However, the Burj Dubai's construction manager, has said only that the final height would be greater than 700 m (2,297 ft), and that it would be the world's tallest free-standing structure when completed

----------------------------------------------------------------------------------------------------
Chile : Strongest Earthquake on the Earth
Chile, 1960 May 22 19:11:14 UTC - Severe damage from shaking occurred in the Valdivia-Puerto Montt area. Most of the casualties and much of the damage was because of large tsunamis which caused damage along the coast of Chile from Lebu to Puerto Aisen and in many areas of the Pacific Ocean. Puerto Saavedra was completely destroyed by waves which reached heights of 11.5 m (38 ft) and carried remains of houses inland as much as 3 km (2 mi). Wave heights of 8 m (26 ft) caused much damage at Corral.

The Largest Earthquake in the World measured measured 9.5 on the Richter scale. Approximately 1,655 killed, 3,000 injured, 2,000,000 homeless, and $550 million damage in southern Chile; tsunami caused 61 deaths, $75 million damage in Hawaii; 138 deaths and $50 million damage in Japan; 32 dead and missing in the Philippines; and $500,000 damage to the west coast of the United States.
----------------------------------------------------------------------------------------------------
Colca Canyon, Peru : Deepest Canyon on the Earth
Twice as deep as the Grand Canyon in the USA. Unlike most of the Grand Canyon, portions of the Colca canyon are habitable, with pre-Colombian terraced fields still supporting agriculture and human life.
The river and valley were well-known to the Incas and their predecessors, and the Spaniards laid out townships along the valley, built churches along the way, notably the one at Coporaque, but for some reason, the towns never grew and the route faded from outside memory.
It wasn't until the early 1930's that the Colca valley was explored again, this time for the American Geographical Society. Colca Valley has been known by different names: The Lost Valley of the Incas, The Valley of Wonders, The Valley of Fire and The Territory of the Condor. It has even been called one of the Seven Natural Wonders of the World."
In the 1980's, with the Majes Hydroelectric Project, roads opened the Colca to the outside. One of the attractions to visitors is a glimpse into a way of life that has endured in isolation for centuries.


---------------------------------------------------------------------------------------------------

Mt. Washington Observatory : Windiest place on the Earth
From 1932 to 1937, the Mt Washington Observatory was operated in the Summit Stage Office then occupying this site. In a great storm April 12, 1934, the crew's instruments measured a wind velocity of 231 miles per hour, highest ever measured by an instrument



More here..

---------------------------------------------------------------------------------------------------

Millau Viaduct : Tallest bridge On The Earth
The Millau Viaduct (French: le Viaduc de Millau) is a cable-stayed road bridge that spans the valley of the River Tarn near Millau in southern France. Designed by French bridge engineer Michel Virlogeux in collaboration with British architect Norman Foster, it is the tallest vehicular bridge in the world, with one pier's summit at 343 meters (1,125 ft)�slightly higher than the Eiffel Tower and only 38 m (125 ft) shorter than the Empire State Building. It was formally opened on 14 December 2004 and opened to traffic on 16 December 2004.

Its construction took only three years, thanks to a pre-fabrication process in which 2,000 sections of the steel roadway were manufactured off-site, lifted into place, and aligned with the help of a GPS. The technique also allowed for the minimum disruption of the surrounding environment -- echoing the bridge's overall goal of relieving the river valley of traffic while connecting the highway systems of France and Spain. Its remarkably slender profile and the way its graceful span emphasizes the drama of the landscape prove that cutting-edge building technology need not be at odds with the natural landscape
---------------------------------------------------------------------------------------------------
Mt. Baker, Washington : Snowiest Place On The Earth
The highest seasonally cumulative precipitation of snow ever measured was on Mount Baker, Washington during the 1998�1999 season. Mount Baker received a staggering 29 m of snow, thus surpassing the previous record holder, Mount Rainier, Washington which during the 1971�1972 season received 28.5 m of snow.
Courtesy : Wikipedia

---------------------------------------------------------------------------------------------------

Great Barrier Reef , Australia : Largest natural feature on the Earth
The Great Barrier Reef is undisputed as one of the world�s most important natural assets. It is the largest natural feature on earth stretching more than 2,300km along the northeast coast of Australia from the northern tip of Queensland to just north of Bundaberg.

The Great Barrier Reef is one of the wonders of the natural world. It is World Heritage listed and is one of Australia's, and the world's, premier holiday destinations.

The Great Barrier Reef is home to more than 1500 species of fish
Photo courtesy of Voyages Australian Resorts
The area abounds with wildlife, including dugong and green turtles, varieties of dolphins and whales, more than 1500 species of fish, 4000 types of mollusc and more than 200 species of bird life. The Great Barrier Reef system consists of more than 3000 reefs which range in size from 1 hectare to over 10,000 hectares in area. The reef is scattered with beautiful islands and idyllic coral cays and covers more than 300,000 square kilometers.
---------------------------------------------------------------------------------------------------
Karl-Marx-Hof, Vienna, Austria : Longest residential building on the Earth
The Karl-Marx-Hof in Vienna, Austria holds the distinction of being the longest single residential building in the world at over one kilometer in length (1100m) and spanning four tram stops.
Karl-Marx-Hof was built between 1927 and 1930 by city planner Karl Ehn, a follower of Otto Wagner. It held 1,382 apartments (with a size of 30-60 m� each) and was called the Ringstra�e des Proletariats, or the Ring Street of the Proletariat. Only 18.5% of the 1,000 meters long, 156,000-m� large area was built up, with the rest of the area developed into play areas and gardens. Designed for a population of about 5000, the premises include many amenities, including laundromats, baths, kindergartens, a library, doctor offices, and business offices.

More Images can be seen HERE
---------------------------------------------------------------------------------------------------
Morecambe Bay : Largest Quicksand on the Earth
Morecambe Bay is a large bay in northwest England, nearly due east of the Isle of Man and just to the south of the Lake District National Park. It is the largest expanse of inter tidal mudflats and sand covering a total area of 310 km�.

The bay is also notorious for its quicksand and fast moving tides (it is said that the tide can come in "as fast as a horse can run"). There have been royally appointed local guides (holding the post of Queen's Guide to the Sands) for crossing the bay for centuries. This difficulty of crossing the bay added to the isolation of the land to its north which, due to the presence of the mountains of the Lake District, could only be reached by crossing these sands or by ferry, until the Furness Railway was built in 1867. This skirts the edge of the bay, crossing the various estuaries.
---------------------------------------------------------------------------------------------------
Coco de mer , Seychelles : Largest Seed on the Earth
The Coco de mer (Lodoicea maldivica), the sole member of the genus Lodoicea, is a palm endemic to the islands of Praslin and Curieuse in the Seychelles. It formerly also occurred on St Pierre, Chauve-Souris and Round Islands in the Seychelles group, but has become extinct on these islands.
It grows to 25-34 m tall. The leaves are fan-shaped, 7-10 m long and 4.5 m wide with a 4 m petiole. It is dioecious, with separate male and female plants. The male flowers are catkin-like, up to 1 m long. The mature fruit is 40-50 cm diameter and weighs 15-30 kg, and contains the largest seed in the plant kingdom. The fruit, which requires 6-7 years to mature and a further two years to germinate, is sometimes also referred to as the sea coconut, double coconut, coco fesse, or Seychelles nut.
The Seychelles nut was once believed to be a sea-bean or drift seed, a seed designed to be dispersed by the sea. However, it is now known that the viable nut is too heavy to float, and only rotted out nuts can be found on the sea surface; this explains why the trees are limited in range to just two islands. The sailors who first saw the nut floating in the sea imagined that it resembled a woman's disembodied buttocks. This fanciful association is reflected in one of the plant's archaic botanical names, Lodoicea callypige Comm. ex J. St.-Hil., in which callipyge is from Greek words meaning 'beautiful rump'. Other botanical names used in the past include Lodoicea sechellarum Labill. and Lodoicea sonneratii (Giseke) Baill.

Until the true source of nut was discovered in 1768, it was believed by many to grow on a mythical tree at the bottom of the sea; European nobles in the sixteenth century would often have the shells of these nuts cleaned and decorated with valuable jewels as collectibles for their private galleries. The coco de mer is now a rare protected species.
The name of the genus, Lodoicea, is derived from Lodoicus, the Latinised form of Louis, in honor of King Louis XV of France.
The species is grown as an ornamental tree in many areas in the tropics, and subsidiary populations have been established on Mah� and Silhouette Islands in the Seychelles to help conserve the species.
---------------------------------------------------------------------------------------------------
Jack Hills, Australia : Oldest piece of earth on th Earth
The Jack Hills are located in the Narryer Gneiss Terrane of the Yilgarn Craton, Western Australia, and comprise an 80 km long northeast-trending belt of folded and metamorphosed supracrustal rocks.This is the oldest piece of earth on the earth
Sedimentary siliciclastic rocks, interpreted as alluvial fan-delta deposits, are the major lithology. Minor mafic/ultramafic rocks and banded iron formation (BIF) are also found in the sequence. The overall sequence is generally considered to be a granulite gneiss, which has undergone multiple deformations and multiple metamorphic episodes. The protolith age of the Narryer Gneiss Terrane is variable, but generally considered to be in excess of 3.6 Ga (billion years).

Detrital zircons with ages >4000 Ma (billion years) have been found in these rocks and a 4,404 +/- 8 Myr zircon was found at Eranondoo Hill (Wilde et al., 2001), the oldest dated material on Earth. They were found within part of the 3.6-3.8 Ga (billion years) supracrustal sequence. These zircons are considered most likely to have been placed into these rocks by erosion of older material.

See this post by blt for more information
or
Here
----------------------------------------------------------------------------------------------------
Seoul, Korea : Most populated city on the Earth
Comparing the populations of the world's largest cities can be a confusing task, as the definition of a city for census consideration can vary from one nation to another. In the US, for example, a city's population includes only those who reside within its political limits. In other countries, a city's suburban and outlying rural area residents can also be included in its census figures.
This is based on information compiled by the Statistics Division Cities Population Database.
Seoul, South Korea with an approximate 10,321,449 is the most populated city on the earth. The capital of South Korea and once the ancient capital of the Baekje Kingdom (18 B.C. - 660 A.D.), Seoul literally means "capital" in Korean.
Metropolitan Seoul, with approximately 20.7 million people, is the world's fourth largest urban center, just behind Tokyo-Yokohama, Mexico City and Sao Paulo.
Founded in 1394 as the capital of the Kingdom of Choson, contemporary Seoul is the site of Caribbean Bay ( approximately 18km southeastward from city boundary ), the world's largest water park, which opened in 1996. It set a record for water park attendance, as more than 1.5 million people visited it within its first two years of inception


----------------------------------------------------------------------------------------------------
Rafflesia arnoldii, Indonesia : Largest Single Flower / parasite on the Earth

Several species of Rafflesia grow in the jungles of Southeast Asia, all of them threatened or endangered. Rafflesia arnoldii is the largest; its blossom attains a diameter of nearly a meter and can weigh up to 11 kg. Not only is it the world's largest flower, it is one of the most bizarre and improbable organisms on the planet. The largest flower in the world is actually a parasite!

It produces no leaves, stems or roots but lives as a parasite on the Tetrastigma vine, which grows only in primary (undisturbed) rainforest. Only the flower or bud can be seen; the rest of the plant exists only as filaments within its unfortunate host.
The Rafflesia is rare and fairly hard to locate. It is especially difficult to see in bloom; the buds take many months to develop and the blossom lasts for just a few days. How many of these strange plants still survive is unknown, but the last of them can be expected to vanish as the remaining primary forests of Borneo and Sumatra are burned
The rare Rafflesia, found only in the forests of Indonesia and Malaysia, grows from spores and takes about nine months to produce a flower - the mahkota, or inner cup, of large Rafflesia can hold several quarts of water.
The blossom is pollinated by flies attracted by its scent, which resembles that of carrion.Like the Amorphophallus, this flower stinks - the dead meat smell attracts flies. Because of its nine month gestation period, Rafflesia is linked with fertility traditions by tribal people living in the areas where it grows.

Rafflesia bud, one day before opening.

� Karl Lehmann
Bloom

� Karl Lehmann
Look at the size

� Karl Lehmann
Photo courtesy of Lost World Arts

----------------------------------------------------------------------------------------------------
Voronya Cave, Krubera, Georgia : Deepest Cave on the Earth
The Voronya Cave (aka Krubera-Voronia Cave) is the deepest known cave in the world. It is located in the Arabika Massif, West Caucasus, Abkhazia (a region of Georgia in the former Soviet Union). The height difference in the cave is 2,140 (� 9) meters.


See the multimedia content from National Geographic
HERE

----------------------------------------------------------------------------------------------------
Roe River, Montana : Shortest river on the Earth

The Roe River, which runs between the Missouri River and Giant Springs near Great Falls, Montana, is the shortest river in the world. Officially it is only 201 feet (61 meters) long. Lewis and Clark were the first white men to see Giant Springs and Roe River and it has been preserved today by the state of Montana for us to see and enjoy.

Oregon's D River also has a claim as the shortest river in the world. However in practice the length of both rivers can vary substantially, and to date the Roe River remains the shortest river officially.



(a special thanks to frank for locating this )
----------------------------------------------------------------------------------------------------
Vredefort Crater, South Africa : Largest impact crater on the Earth
Vredefort crater is the largest known impact crater on Earth. Located in the Free State Province of South Africa, the town of Vredefort is situated in the crater. The site is also referred to as Vredefort dome or Vredefort impact site. In 2005, the Vredefort Dome was added to the list of UNESCO World Heritage Sites for its scenic and scientific interest. Dating back 2,023 million years, it is the oldest astrobleme found on earth so far. With a radius of 190km, it is also the largest and the most deeply eroded. Vredefort Dome bears witness to the world�s greatest known single energy release event, which caused devastating global change, including, according to some scientists, major evolutionary changes. It provides critical evidence of the earth�s geological history and is crucial to our understanding of the evolution of the planet. Despite their importance to the planet�s history, geological activity on the earth�s surface has led to the disappearance of evidence from most impact sites and Vredefort is the only example on earth to provide a full geological profile of an astrobleme below the crater floor.

----------------------------------------------------------------------------------------------------
ScoresbySund Fjord, Greenland : Longest & Deepest Fjord on the Earth
Stretching for 350 km (217 miles) this fjord is the longest on the planet earth. It is located in East Greenland , relatively close to Iceland. This is also the deepest fjord at 1500 m deep

Fjord is a narrow inlet of the sea between cliffs or steep slopes. It is typically applied to a narrow inlet in a glacially over deepened valley, usually narrow and steep-sided, extending below sea level and filled with salt water.A fjord is formed when a glacier retreats, after carving its typical U-shaped valley, and the sea fills the resulting valley floor. This forms a narrow, steep sided inlet (sometimes as deep as 1300 m) connected to the sea.

For high resolution image overlay click HERE
----------------------------------------------------------------------------------------------------
Isaouane-n-Tifernine, Algeria : Highest Sand Dunes on the Earth
The world's highest measured sand dunes are those in the Saharan sand sea of Isaouane-n-Tifernine in east-central Algeria. They have a wavelength of 5 km (3 miles) and attain a height of 465 m (1,526 ft).
The nearest oasis is 100 kilometers (62 miles) away. The structures within the dune field are highlighted by the evening Sun, giving a better perspective on their height and morphology. To the north of the photograph the dunes most frequently form in long crescents or "barchans" with a steep, convex face toward the prevailing winds from the west or southwest. To the south of the dune field star dunes predominate, indicating that there is no consistent wind direction there.

This photograph vividly displays the differences between these two major landforms.

The Tifernine Dunes were named after the intermittently-flowing, south-to-north Tifernine watercourse along the southwestern edge of the dunes. The dark, weathered sandstone rocks that border the Tifernine Dunes to the east and southwest have deep, narrow ravines that comprise a well-entrenched drainage pattern through the higher elevations of the surrounding plateau. This erosion process began millions of years ago when the climate was much wetter. This region now receives less than 1 inch (2.5 centimeters) of rainfall annually.

This distinctive geographical feature provides Space Shuttle astronauts with a reference point in the much larger Sahara Desert
----------------------------------------------------------------------------------------------------

Bishop Rock, Isles of Scilly : Smallest Island on the Earth
Bishop Rock is a small rock at the westernmost tip of the Isles of Scilly, known for its lighthouse, and listed in the Guinness Book of Records as the smallest island in the world.
Containing room for nothing more than the uninhabited 45 metre tall lighthouse, the rock acts as the barrier between the British Isles and the Atlantic Ocean. The original lighthouse was begun in 1847, but was washed away before it could be completed. The present building was completed in 1858.
Standing on a rock ledge four miles west of the Scillies, Bishop Rock Lighthouse faces the full force of the Atlantic's waves daily.Bishop Rock was one of the most hazardous and difficult sites for the building of a lighthouse when work first begun on its construction.There are about 5,700 tonnes of granite without any steelwork, glass engines and helipad at the moment. They're all dove-tailed with lead filling, and bolted into the actual granite rock which is underneath.Bishop Rock's light shines out for 24 nautical miles.

In the old days the lighthouse had to rely on paraffin vapor lamps and, before that, candles.Today there are generators, batteries and a helipad which was built in 1976 - this means visitors can actually land on top of the lighthouse instead of coming in by boat. Bishop Rock was converted to automatic operation in 1991 and the last keepers left the lighthouse in December 1992.

Today the lighthouse has ten floors, and up to four visitors can stay here for a week to three weeks. The control room is on the third floor - the lighthouse keepers can work on the station, manually, or remotely from their headquarters in Harwich, Essex.

Bishop Rock is a wonder indeed, especially in glorious weather, but to withstand autumn gales and winter storms for months on end, perhaps that's where the true wonder of this place lies.

Copyrights : Gibson's of Scilly & The Cornwall Guide
----------------------------------------------------------------------------------------------------
Lake Manitou : Largest lake within a freshwater island in the world
Lake Manitou holds the Guinness World Records as "the largest lake within a freshwater island in the world." The lake about 104 km� is located in the Manitoulin Island , which is the is the world's largest freshwater lake island.

With an area of 2,766 km� (1,068 square miles), it is the 174th largest island in the world, and Canada's 31st largest island. Part of Ontario, Canada, the island separates the larger part of Lake Huron to its south and west from Georgian Bay to its east. Manitoulin Island itself has 108 freshwater lakes, some of which have their own islands; in turn a few of these "islands within islands" have their own ponds. spawning grounds for Atlantic Salmon and trout.
----------------------------------------------------------------------------------------------------
Red Sea : Warmest & Saltiest sea on the Earth
The warmest sea in the world is the Red Sea, where temperatures range from 68 degrees to 87.8 degrees F depending upon which part you measure.

Red sea is also the saltiest sea in the world with 41 parts of salt per 1,000 parts of water.
----------------------------------------------------------------------------------------------------
Indonesia : Biggest Archipelago on the Earth
Indonesia is the largest archipelago in the world. It consists of five major islands and about 30 smaller groups. The figure for the total number of islands is 17,508 according to the Indonesian Naval Hydro-Oceanographic office. The archipelago is on a crossroads between two oceans, the Pacific and the Indian ocean, and bridges two continents, Asia and Australia. This strategic position has always influenced the cultural, social, political and economic life of the country.

Indonesia has the most number of volcanoes than any other country on the earth

There are five main islands : Sumatra, which is about 473,606 sq. km. in size; the most fertile and densely populated islands, Java/Madura, 132,107 sq. km; Kalimantan, which comprises two-thirds of the island of Borneo and measures 539,460 sq. km; Sulawesi, 189,216 sq. km; and Irian Jaya, 421,981 sq. km, which is part of the world's second largest island, New Guinea. Indonesia's other islands are smaller in size.

The archipelago is divided into three groups. The islands of Java, Sumatra and Kalimantan, and the small islands in-between, lie on the Sunda Shelf which begin on the coasts of Malaysia and Indo China, where the sea depth does not exceed 700 feet. Irian Jaya which is part of the island of New Guinea, and the Aru Islands lie on the Sahul Shelf, which stretches northwards from the Australian coast. Here the sea depth is similar to that of the Sunda Shelf.
----------------------------------------------------------------------------------------------------
Atlantic Ocean : Saltiest Ocean on the Earth
On the average, the saltiest ocean is thought to be the northern subtropical portions of the Atlantic Ocean, with and average of about 37.5 parts per thousand salinity.
----------------------------------------------------------------------------------------------------
Arctic Ocean : Smallest & least Saltiest Ocean On the Earth
This is due to the melting of ice and rain !!, the average salinity is 30 - 33 parts per thousand salinity.
----------------------------------------------------------------------------------------------------
Mera Peak, Nepal : Greatest Vertical Drop on the Earth
Mera Peak, Nepal, 6604m is the worlds tallest vertical drop.

Glenn Singleman and Heather Swan made a wing suit / base jump from a launch site at 6604m over the East Face of Meru Peak.

Mera Peak lies within the relatively uninhabited Hinku and Hongu valleys south of Mt Everest. At 6476m, it is the highest non-expedition peak in Nepal & Greatest Vertical Drop on the earth. The walk towards the summit is very long but never really steep; the last 15 to 30 minutes just before the summit are steep.

� Robert Sulej Image courtesy of www.peakware.com
----------------------------------------------------------------------------------------------------
Lake Titicaca : Highest Navigable Lake on the Earth
Lake Titicaca (Spanish: Lago Titicaca), at 3821 m (12,536 feet) above sea level, is the highest commercially navigable lake in the world. It is also South America's largest freshwater lake, with a surface area of approximately 8300 square kilometers.
Located in the Altiplano high in the Andes on the border of Peru and Bolivia, Titicaca has an average depth of between 140 and 180 m, and a maximum depth of 280 m. The western part of the lake belongs to the Puno Region of Peru, and the eastern side is located in the Bolivian La Paz Department.
[img]http://www.cynthia.boxerman.co.uk/images/Lake%20Titicaca%20views%20(1).JPG[/img]
----------------------------------------------------------------------------------------------------
Dead Sea, Israel & Jordan : Lowest Elevation on the Earth

he Dead Sea is a salt lake between Israel to the west and Jordan to the east. It is 420 metres (1,378 ft) below sea level, and its shores are the lowest point on the surface of the Earth on dry land. The Dead Sea is 330 m (1,083 ft) deep, the deepest hypersaline lake in the world. It is also the world's second saltiest body of water, after Lake Asal in Djibouti, with 30 percent salinity. It is 8.6 times saltier than the ocean. Israeli experts say that it is nine times saltier than the Mediterranean Sea (31.5% salt versus 3.5% for the Mediterranean). The Dead Sea is 67 kilometers (42 mi) long and 18 kilometers (11 mi) wide at its widest point. It lies in the Jordan Rift Valley, and its main tributary is the Jordan River.

The Dead Sea has attracted visitors from around the Mediterranean basin for thousands of years. It was one of the world's first health resorts, and it has been the supplier of a wide variety of products, from balms for Egyptian mummification to potash for fertilizers.
[img]http://english.people.com.cn/200604/17/images/0416_A67.jpg[/img]

----------------------------------------------------------------------------------------------------
Challenge Deep , Mariana's Trench : Deepest point on the Earth
Challenger Deep got its name from the British survey ship Challenger II, which pinpointed the deep water off the Marianas Islands in 1951. Then in 1960, the US Navy sent the Trieste (a submersible - a mini-submarine designed to go really deep) down into the depths of the Marianas trench to see just how far they would go. They touched bottom at 35,813 ft/10,915m. That means, while they were parked on the bottom in the bathyscaphe, there were almost seven miles/11km of water over their heads!
If you cut Mount Everest off at sea level and put it on the ocean bottom in the Challenger Deep, there would still be over a mile of water over the top of it!
The deepest measurement of the Challenger Deep currently available was taken by the Japanese and was found to be 35,838 feet.
A plaque to commemorate the world record for the deepest dive to the bottom of the Mariana Trench in 1995
[img]http://www.abc.net.au/science/news/img/environment/plaque.jpg[/img]
----------------------------------------------------------------------------------------------------
Mt. Everest, Nepal : Highest Elevation on the Earth
The mountain is approximately 8,844 m (29,015 feet) high, although there is some variation in the measurements. The mountain K2 comes in a close second at 28,251 feet high. The reason Mount Everest does not appear to be 29,017 feet tall is because many photos are taken at Everest Base Camp, which is at 17,585 Feet, above Sea Level, which means that the summit of Everest is only about 11,432 feet higher. On May 22, 2005, the People's Republic of China's Everest Expedition Team ascended to the top of the mountain. After several months' complicated measurement and calculation, on October 9, 2005, the PRC's State Bureau of Surveying and Mapping officially announced the height of Everest is 8844.43 m (29,017.07 ft). This new height is based on the actual highest point of rock and not on the snow and ice that sits on top of that rock on the summit. They claimed it was the most accurate measurement to date.
Edmund Hillary and Tenzing Norgay were the first men to ever reach the summit of Mt. Everest . Since then approximately 1,200 men and women have made the daring journey to the top of Everest.
[img]http://peace.sandiego.edu/images/programs/Mount%20Everest.jpg[/img]
----------------------------------------------------------------------------------------------------
El Azizia , Libya : Hottest place on the Earth
[img]http://www.enricopezzi.it/AEP/p3-26_ten/foto/1923p%20Azizia_01w.jpg[/img]
On September 13, 1922 the meteorological station in El Azizia recorded a blistering 136� F/ 57.8� C, Note that this was the temperature on the thermometer in an enclosed shelter 5 m above ground , some claim that the actual temperature on the ground could have reached 150� F/ 66� C !! and else where meters away from the Met dept the temperature could have been still higher !!
[img]http://www.ilv.ucl.ac.be/ILV-US/modules/coppermine/albums/userpics/10002/normal_Death%20%20Valley%20California%2005.jpg[/img]
Death Valley, California comes in a close second, On July 10, 1913 this place recorded 134� F/ 56.6�C .

These records are based on the air temperature measurements done by weather stations scattered across the earth. But the actual temperature on the surface of the earth at that point of time could have been much higher. A NASA satellite recorded surface temperatures in the Lut desert of Iran as high as 71 �C (159 �F)[2], the hottest temperature ever recorded on the surface of the Earth.
[img]http://www.spiegel.de/img/0,1020,743181,00.jpg[/img]
Image Courtesy : www.spiegel.de
----------------------------------------------------------------------------------------------------
Vostok station, Antarctica : Coldest place on the Earth
[img]http://www.atmosphere.mpg.de/media/archive/4975.jpg[/img]
Vostok Station is a Russian research station located near the Geomagnetic South Pole (see South Pole), at the center of the East Antarctic Ice Sheet. The station is 3488 m above sea level. It is the most isolated of all of the established research stations on the Antarctic continent.
It is the place on Earth at which the lowest temperature has been reliably measured (though since the temperature decreases with height, it is virtually certain that lower temperatures occurred higher up towards the summit of the ice sheet). During the long winter, temperatures average about −65 �C; in the brief summer, about −30 �C. The place is known as the Southern Pole of Cold. The coldest temperature ever recorded on Earth, −89.2 �C, was measured here on 21 July 1983. Although still unofficial, an even colder temperature, −91 �C, was reported during the winter of 1997.
In 1996, Russian and British scientists discovered Lake Vostok, the largest known subglacial lake in the world underneath Vostok Station. Lake Vostok lies some 4,000 meters (13,000 feet) below the surface of the central Antarctic ice sheet and covers an area of 14,000 square kilometers (5,400 square miles).
It was built in 1957 (IGY) and named for one of Bellinghausen's two ships, Vostok (East). Although this is a Russian research station, scientists from all over the world conduct research here. One of the primary projects at this site, a coordinated Russian, French and American effort, is drilling an ice core through the 3,700 m thick ice sheet. This ice core contains climate records for almost half a million years before present.
----------------------------------------------------------------------------------------------------
Cherrapunji, India : Wettest place on the Earth
[img]http://upload.wikimedia.org/wikipedia/commons/thumb/f/ff/Cherrapunji.jpg/240px-Cherrapunji.jpg[/img]
The city of Cherrapunji at 1290 m above sea level is the wettest place on the Earth.
In Cherrapunji it rains so much for two reasons:
- Elevation: because of the elevation of Cherrapunji, air that blows over the plains below is cooled as it rises to the higher elevation. This cooling of the air causes the moisture trapped in the air to condense, forming clouds, which then release rain.
- Monsoons: the prevailing winds in that part of the world are very heavily laden with moisture. The constant supply of moist air for six months straight results in almost continual rainfall
[img]http://www.kidzworld.com/img/upload/article/a1011i1_cherrapunji2.jpg[/img]
----------------------------------------------------------------------------------------------------
Atacama Desert, Chile : Driest place on the Earth
[img]http://www.nathanward.com/Photographs-Planet-Earth/dry_riverbeds_and_no_green_Atacama_Desert_Chile.jpg[/img]
Photo Courtesy - www.Nathanward.com

The Atacama desert receives on an average less than .004 in / .01 cm of rainfall per year , some parts of this desert have not received rainfall for over 400 years !!
The Atacama desert is nestled along the coast of Chile, South America - right next to the Pacific Ocean - the biggest body of water in the world. Much of the desert extends up into the Andes mountains and is very high in elevation. Unlike more familiar deserts, like the Sahara desert in Africa and the Mojave in California, the Atacama is actually a pretty cold place, with average daily temperatures ranging between 0�C and 25�C. The annual rainfall (or lack of it) defines a desert, but that doesn't mean that it never rains in Atacama. Every so often a warming effect over the Pacific Ocean around the equator changes the weather the world over and even places like the driest desert in the world can become doused with drenching storms. Even though Atacama gets almost no rainfall, there is water in this arid place in the form of Salt Lakes, Snow, Underground Water Fog and Dew.

Some contend that Antarctica is the driest place on earth , technically it is a dessert. It receives less than two inches of precipitation a year, about the same amount of precipitation as the Sahara Desert.

One interior region of the Antarctic is known as The Dry Valleys. These valleys have not seen rainfall in over two million years!!. With the exception of one valley, whose lakes are briefly filled with water by inland flowing rivers during the summer, the Dry Valleys contain no moisture (water, ice, or snow). The reason why the Dry Valleys exist are the 100 mph Katabatic down winds which evaporate all moisture.

I leave it to you to decide which one you consider as the driest place on the earth
----------------------------------------------------------------------------------------------------
Mill Ends Park, Portland, Oregan : Smallest Park on the Earth
Mill Ends Park in Portland, Oregon is the smallest park in the world, according to the Guinness Book of Records. The "park" is a 2 foot (610 mm) wide circle which in 1948 was intended to be the site for a light pole. When this failed to appear, Dick Fagan, a journalist for the Oregon Journal, planted flowers in the hole and named it after his column in the paper, "Mill Ends". Fagan told the story of the park's origin as follows: He looked out his office window and spotted a leprechaun digging in the hole. He ran down and grabbed the leprechaun, which meant that he had earned a wish. Fagan said he wished for a park of his own; but since he had not specified the size of the park in his wish, the leprechaun gave him the hole. Over the next two decades, Fagan often featured the park and its head leprechaun, named Patrick O'Toole, in his whimsical column.
Fagan died of cancer in 1969, but the park lived on, cared for by others. It became an official city park in 1976. Mill Ends Park is located at SW Naito Parkway and SW Taylor in downtown Portland.
The park's area is 452 in� (0.29 m�). The small circle has featured many unusual items through the decades, including a swimming pool for butterflies (complete with diving board) and a miniature ferris wheel (which was delivered by a regular-sized crane).
[img]http://www.oregon.com/trips/images/mills.jpg[/img]
Courtesy : Wikipedia
----------------------------------------------------------------------------------------------------
Angel Falls, Venezuela : Tallest water fall on the Earth
Angel Falls or Salto �ngel is the world's highest free-falling waterfall at 979 metres (3,230 feet) with an uninterrupted drop of 807 m (2,647 feet). It is located on an unnamed tributary of the Rio Caroni, in the Canaima National Park, Venezuela.
Angel Falls is the tallest waterfall in the world, as well as the tallest single drop in the world. The falls consist of a 2648 foot plunge, where the water comes out of the face of Auyan Tepui, then it cascades down steep talus before dropping over another 100 foot cascade. No one seems to know what the stream the falls occur on is called. For the longest time, there have been references to Angel Falls being known in Pem�n (the local language) as Chur�n Mer�, and the falls subsequently being on Rio Chur�n. However, the real Pem�n name of the falls is Kerepakupai Mer�, which means "fall from the deepest place". To further clear this issue, Chur�n Mer� is a totally different waterfall of about half the height of Angel Falls, located further up the large canyon bysecting Auyan Tepui. The top of the Tepui from which the falls drop is heavily fractured and jointed sandstone. The waters above the falls drop into a series of cracks, crevices, and gorges and burst out of the cliff face about 50 feet below the brink. The waterfall segments in periods of highest water. We've seen photos that show the falls split into 3 major portions,

[img]http://static.flickr.com/25/64461045_e8fc177bdb_o_d.jpg[/img]

creating a veil of water on the order of 600' in width. Pilot Jimmy Angel is widely credited for discovering the falls in 1937, but the true discoverer was one Ernesto de Santa Cruz, who found the falls in 1910. The falls were subsequently named for Jimmy Angel, since he was the first westerner to view the falls.
----------------------------------------------------------------------------------------------------
Mauna Loa, Hawii : Biggest Mountain on the Earth
If you thought Mt. Everest , You are wrong <img src="/ubb/images/graemlins/wink.gif" alt="" />
Everest is the highest elevation on land, but it is only a single peak in an entire mountain range. Mauna Loa is a single mountain on the island of Hawaii. The island of Hawaii is actually an island made up of five volcanoes which "blend" together because of their closeness to each other, making a single island.
Only about 13,448 ft/4100m of Mauna Loa are above sea level, so it may not seem like a very tall mountain. But, when you start measuring Mauna Loa from its true base on the bottom of the ocean, in the Hawaiian Trough, the total height exceeds that of Everest by over 3/4 of a mile. The total height is around 33,132 ft / 10,099 mts !!.
Mauna Loa is Hawaiian for "Long Mountain", probably because of its long, gently sloping shape.

----------------------------------------------------------------------------------------------------
Mauna Kea, Hawii : Tallest Mountain on the Earth
If you want to get really technical, Mauna Kea, a neighbor of Mauna Loa on the same island of Hawaii, is actually the tallest mountain in the world at 33,472 ft / 10, 206 mts. Mauna Kea is about 350 ft/107m taller than Mau


Attachments
Extreme series.kmz (2979 downloads)
Preview this file with the Google Earth Plugin (learn more)


Edited by satishgsk (07/03/09 04:06 AM)
Edit Reason: Added Sultan Qaboos Grands Mosque in Bausher, Sultanate of Oman :Largest Hand-woven Carpet and Chandelier on the Earth

Top
#309224 - 02/06/06 01:47 AM Re: Extreme Series [Re: satishgsk]
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Surprised none has challenged or updated this !!
_________________________
Satishgsk

Top
#309225 - 02/06/06 02:16 AM Extreme Series - Updated [Re: satishgsk]
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Updated with more extremes mountains and ice sheets


Attachments
302764-Extremeseries.kmz (4722 downloads)
Preview this file with the Google Earth Plugin (learn more)


Edited by satishgsk (02/07/06 02:30 AM)
_________________________
Satishgsk

Top
#309226 - 02/07/06 02:26 AM Extreme Series - Updated -Tallest Water fall [Re: satishgsk]
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Extreme Series - Updated -Tallest Water fall
_________________________
Satishgsk

Top
#309227 - 02/07/06 03:01 AM Extreme Series - Updated -Deepest Lake [Re: satishgsk]
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Extreme Series - Updated -Deepest Lake
_________________________
Satishgsk

Top
#309228 - 02/07/06 03:08 AM Re: Extreme Series - Updated [Re: satishgsk]
firefysh Offline
Traveler

Registered: 10/19/05
Posts: 1362
Loc: Ashby, Western Australia.
An excellent piece of work, satishgsk.
Congratulations.

firefysh.
_________________________
A positive attitude may not solve your problems, but the number of people it will annoy makes it worth while.

Top
#309229 - 02/07/06 03:24 AM Re: Extreme Series - Updated [Re: firefysh]
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Quote:

An excellent piece of work, satishgsk.
Congratulations.

firefysh.




Thanks Firefysh
_________________________
Satishgsk

Top
#309230 - 02/07/06 04:14 AM Re: Extreme Series - Updated [Re: satishgsk]
Jimmy_Lemon Offline
Gamer

Registered: 07/26/05
Posts: 723
Loc: Skipton, UK (GMT+1)
Thats a good read. I didn't know much of that nice work!
_________________________

Top
#309231 - 02/07/06 05:53 AM Re: Extreme Series - Updated [Re: Jimmy_Lemon]
IanUK Offline
Traveler

Registered: 08/24/05
Posts: 1160
Loc: Aylesbury, England, GMT+0
What a great post!

I must confess, I haven't looked at the placemarks as I know where most of these are, but I didn't know all the facts and info you provided. Thanks satishgsk !!!


Edited by IanUK (02/07/06 05:54 AM)

Top
#309232 - 02/07/06 08:58 PM Re: Extreme Series - Updated [Re: IanUK]
satishgsk Offline
Extreme Explorer

Registered: 11/07/05
Posts: 233
Thanks Ian
_________________________
Satishgsk

Top
Page 1 of 9 1 2 3 4 5 6 7 8 9 >